Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502136

Solute Carrier Family 22 Member 6 (SLC22A6) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HOAT1, OAT1, PAHT, ROAT1, NKT, Oat1, mOat1, Orctl1, slc22a6, zgc:77073, Paht, Roat1, nkt, oat1, oat1-B, paht, roat1, slc22a6-B, Slc22a6, SLC22A6
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502136
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC22A6 antibody: synthetic peptide directed towards the C terminal of human SLC22A6
Sequence ETLGQPLPDTVQDLESRWAPTQKEAGIYPRKGKQTRQQQE HQKYMVPLQA
Predicted Reactivity Horse : 100%, Rat : 100%, Dog : 92%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against SLC22A6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SLC22A6
Background SLC22A6 is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane.The protein encoded by this gene is involved in the sodium-dependent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and may be localized to the basolateral membrane. Four transcript variants encoding four different isoforms have been found for this gene.
Molecular Weight 62kDa
Gene ID 9356
NCBI Accession NP_004781, NM_004790
UniProt Q4U2R8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC22A6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Windass, Lowes, Wang et al.: "The contribution of organic anion transporters OAT1 and OAT3 to the renal uptake of rosuvastatin." in: The Journal of pharmacology and experimental therapeutics, Vol. 322, Issue 3, pp. 1221-7, 2007 (PubMed).

Alternatives for antigen "Solute Carrier Family 22 Member 6 (SLC22A6)", type "Antibodies"
Hosts (44), (2)
Reactivities (30), (23), (20), (1), (1), (1), (1), (1)
Applications (26), (20), (14), (11), (11), (3), (1), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (7), (3), (2), (2), (1), (1)
Beacon