Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502194

Chemokine (C-X-C Motif) Receptor 2 (CXCR2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CD182, CDw128b, CMKAR2, IL8R2, IL8RA, IL8RB, CD128, Il8rb, CDw128, Cmkar2, Gpcr16, IL-8Rh, IL-8rb, mIL-8RH, CXC-R2, CXCR-2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502194
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IL8RB antibody: synthetic peptide directed towards the N terminal of human IL8RB
Sequence MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE PESLEINKYF
Predicted Reactivity Chimpanzee :100%,   Human :100%,   Lowland gorilla :92%,   Bornean orangutan :92%,   Western Gorilla :92%,  
Characteristics This is a rabbit polyclonal antibody against IL8RB. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name IL8RB
Background IL8RB is the receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. IL8RB binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. This receptor also binds to chemokine (C-X-C motif) ligand 1 (CXCL1/MGSA), a protein with melanoma growth stimulating activity, and has been shown to be a major component required for serum-dependent melanoma cell growth. This receptor mediates neutrophil migration to sites of inflammation. The angiogenic effects of IL8 in intestinal microvascular endothelial cells are found to be mediated by this receptor. Knockout studies in mice suggested that this receptor controls the positioning of oligodendrocyte precursors in developing spinal cord by arresting their migration. This gene, IL8RA, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36.
Molecular Weight 41kDa
Gene ID 3579
NCBI Accession NP_001548, NM_001557
UniProt P25025
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-IL8RB antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Gauvreau, Boulet, Cockcroft et al.: "Antisense therapy against CCR3 and the common beta chain attenuates allergen-induced eosinophilic responses." in: American journal of respiratory and critical care medicine, Vol. 177, Issue 9, pp. 952-8, 2008 (PubMed).

Alternatives for antigen "Chemokine (C-X-C Motif) Receptor 2 (CXCR2)", type "Antibodies"
Hosts (89), (34), (2)
Reactivities (120), (34), (34), (24), (12), (12), (12), (1)
Applications (48), (46), (34), (30), (29), (12), (10), (7), (5), (4), (3), (2), (2), (1)
Conjugates (6), (4), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (1), (1), (1), (1), (1), (1), (1)
Epitopes (16), (13), (7), (5), (3), (2), (2), (2), (2), (1), (1), (1), (1)
Beacon