Chemokine (C-X-C Motif) Receptor 2 (CXCR2) antibody

Antigen: Chemokine (C-X-C Motif) Receptor 2 (CXCR2)

Synonyms: CD182, CXCR2, IL8R2, IL8RA, CMKAR2, CDw128b, CD128, Il8rb, CDw128, Cmkar2, Gpcr16, IL-8Rh, IL-8rb, mIL-8RH, Cxcr2, IL8RB

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN502194

Additional Information

Alternative name: CD182 / IL8RB

Gene ID: IL8RB

UniProt: P25025

Immunogen: The immunogen for anti-IL8RB antibody: synthetic peptide directed towards the N terminal of human IL8RB

Sequence: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCE PESLEINKYF

Cross-Reactivity: Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-IL8RB antibody concentration is 1 mg/ml.

Description: IL8RB is the receptor for interleukin-8 which is a powerful neutrophil chemotactic factor. Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system. IL8RB binds to IL-8 with high affinity. IL8RB also binds with high affinity to CXCL3, GRO/MGSA and NAP-2.The protein encoded by this gene is a member of the G-protein-coupled receptor family. This protein is a receptor for interleukin 8 (IL8). It binds to IL8 with high affinity, and transduces the signal through a G-protein activated second messenger system. This receptor also binds to chemokine (C-X-C motif) ligand 1 (CXCL1/MGSA), a protein with melanoma growth stimulating activity, and has been shown to be a major component required for serum-dependent melanoma cell growth. This receptor mediates neutrophil migration to sites of inflammation. The angiogenic effects of IL8 in intestinal microvascular endothelial cells are found to be mediated by this receptor. Knockout studies in mice suggested that this receptor controls the positioning of oligodendrocyte precursors in developing spinal cord by arresting their migration. This gene, IL8RA, a gene encoding another high affinity IL8 receptor, as well as IL8RBP, a pseudogene of IL8RB, form a gene cluster in a region mapped to chromosome 2q33-q36. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Characteristics: Antigen Size: 360 amino acids

Molecular Weight: 41kDa

Application Details

Application Notes: WB Suggested Anti-IL8RB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: CD Antigens, Surface Receptors of Immune Cells

Restrictions: For Research Use only

Images

WB Suggested Anti-IL8RB Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: PANC1 cell lysate

Publications

Product: Gauvreau, Boulet, Cockcroft et al.: "Antisense therapy against CCR3 and the common beta chain attenuates allergen-induced eosinophilic responses." in: American journal of respiratory and critical care medicine, Vol. 177, Issue 9, pp. 952-8, 2008 (PubMed).