Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502382

Tripartite Motif Containing 55 (TRIM55) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms trim55, zgc:92123, wu:fb71c01, MURF-2, RNF29, muRF2, D830041C10Rik, Murf2, Rnf29, TRIM55
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502382
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TRIM55 antibody: synthetic peptide directed towards the N terminal of human TRIM55
Sequence SGGRFRCPSCRHEVVLDRHGVYGLQRNLLVENIIDIYKQE STRPEKKSDQ
Predicted Reactivity Chicken : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Zebrafish : 100%, Bovine : 92%, Dog : 92%, Horse : 92%, Pig : 92%
Characteristics This is a rabbit polyclonal antibody against TRIM55. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TRIM55
Background TRIM55 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres.The protein encoded by this gene contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein associates transiently with microtubules, myosin, and titin during muscle sarcomere assembly. It may act as a transient adaptor and plays a regulatory role in the assembly of sarcomeres. Four alternatively spliced transcript variants encoding distinct isoforms have been described.
Molecular Weight 51kDa
Gene ID 84675
NCBI Accession NP_908974, NM_184086
UniProt B3KRC0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TRIM55 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lange, Xiang, Yakovenko et al.: "The kinase domain of titin controls muscle gene expression and protein turnover." in: Science (New York, N.Y.), Vol. 308, Issue 5728, pp. 1599-603, 2005 (PubMed).

Alternatives for antigen "Tripartite Motif Containing 55 (TRIM55)", type "Antibodies"
Hosts (9), (6), (2)
Reactivities (13), (4), (4), (3), (2), (2), (2), (2), (1)
Applications (14), (8), (2), (1)
Epitopes (3), (3), (3), (1), (1)
Beacon