Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502417

Discs, Large Homolog 3 (Drosophila) (DLG3) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MRX, MRX90, NEDLG, SAP102, XLMR, fa66c08, fa66e02, fd02c12, fu95c12, im:7138640, si:ch211-276g21.1, wu:fa66c08, wu:fa66e02, wu:fd02c12, wu:fu95c12, MPP3, Dlgh3
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502417
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-DLG3 antibody: synthetic peptide directed towards the middle region of human DLG3
Sequence FPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQ DNKFIEAGQF
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against DLG3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name DLG3
Background DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).
Molecular Weight 90kDa
Gene ID 1741
NCBI Accession NP_066943, NM_021120
UniProt Q92796
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-DLG3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Discs, Large Homolog 3 (Drosophila) (DLG3)", type "Antibodies"
Hosts (33), (19)
Reactivities (38), (34), (25), (13), (13), (13), (12), (1), (1), (1)
Applications (42), (10), (9), (9), (9), (4), (4), (3), (2), (1), (1), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (6), (3), (3), (2), (2), (2), (2), (1)
Beacon