Discs, Large Homolog 3 (Drosophila) (DLG3) (Middle Region) antibody

Details for Product No. ABIN502417
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms MRX, MRX90, NEDLG, SAP102, XLMR, fa66c08, fa66e02, fd02c12, fu95c12, im:7138640, si:ch211-276g21.1, wu:fa66c08, wu:fa66e02, wu:fd02c12, wu:fu95c12, MPP3, Dlgh3
Epitope
Middle Region
(6), (6), (3), (2), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Zebrafish (Danio rerio), Pig (Porcine), Human
(38), (30), (24), (13), (13), (13), (12), (2), (1), (1), (1)
Host
Rabbit
(31), (18), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(40), (10), (9), (8), (8), (4), (3), (3), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN502417
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human DLG3
Sequence FPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQ DNKFIEAGQF
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against DLG3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name DLG3
Background DLG3 is required for learning most likely through its role in synaptic plasticity following NMDA receptor signaling. Defects in DLG3 are the cause of mental retardation X-linked type 90 (MRX90).
Molecular Weight 90 kDa
Gene ID 1741
NCBI Accession NM_021120, NP_066943
UniProt Q92796
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 817 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Discs, Large Homolog 3 (Drosophila) (DLG3) (Middle Region) antibody WB Suggested Anti-DLG3 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (31), (18), (1)
Reactivities (38), (30), (24), (13), (13), (13), (12), (2), (1), (1), (1)
Applications (40), (10), (9), (8), (8), (4), (3), (3), (2), (2), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (6), (3), (2), (2), (2), (2), (1), (1), (1), (1)
back to top