Dipeptidyl-Peptidase 6 (DPP6) antibody

Antigen: Dipeptidyl-Peptidase 6 (DPP6)

Synonyms: CD26, ADABP, ADCP2, DPPIV, TP103, VF2, DPPX, FLJ55680, MGC46605, DPRP2, DPP IX, A330078I11, 6430584G11Rik, DPP6, MGC152462, dpp9, DPP9, dpp6, si:ch211-198f16.1, im:7145318, dppx

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Conjugate: Un-conjugated

Application: Western Blotting (WB)

Catalog no.: ABIN502572

Additional Information

Alternative name: DPP6

Gene ID: DPP6

UniProt: P42658

Immunogen: The immunogen for anti-DPP6 antibody: synthetic peptide directed towards the middle region of human DPP6

Sequence: AAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSENPSIS LHVIGLNGPT

Cross-Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-DPP6 antibody concentration is 1 mg/ml.

Description: DPP6 is a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties.This gene encodes a single-pass type II membrane protein that is a member of the S9B family in clan SC of the serine proteases. This protein has no detectable protease activity, most likely due to the absence of the conserved serine residue normally present in the catalytic domain of serine proteases. However, it does bind specific voltage-gated potassium channels and alters their expression and biophysical properties. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Characteristics: Antigen Size: 801 amino acids

Molecular Weight: 91kDa

Application Details

Application Notes: WB Suggested Anti-DPP6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-DPP6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain

Publications

Product: Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).