Metaxin 1 (MTX1) (C-Term) antibody

Details for Product No. ABIN502610
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MTX, MTXN, Mtx, Gcap6, Metaxin-1, mtx1, zgc:101675
Epitope
C-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Pig (Porcine), Human
(7), (3), (3)
Host
Rabbit
(7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN502610
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human MTX1
Sequence CLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLP SGKLQVHLRG
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Pig : 90 %, Zebrafish : 90 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against MTX1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name MTX1
Background MTX1 belongs to the metaxin family. It is involved in transport of proteins into the mitochondrion and essential for embryonic development.
Molecular Weight 51 kDa
Gene ID 4580
NCBI Accession NM_002455, NP_002446
UniProt Q13505
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 466 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Xie, Marusich, Souda et al.: "The mitochondrial inner membrane protein mitofilin exists as a complex with SAM50, metaxins 1 and 2, coiled-coil-helix coiled-coil-helix domain-containing protein 3 and 6 and DnaJC11." in: FEBS letters, Vol. 581, Issue 18, pp. 3545-9, 2007 (PubMed).

Hosts (7)
Reactivities (7), (3), (3)
Applications (6), (2), (2)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top