Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502610

Metaxin 1 (MTX1) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MTX, MTXN, Mtx, Gcap6, Metaxin-1, mtx1, zgc:101675
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502610
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-MTX1 antibody: synthetic peptide directed towards the C terminal of human MTX1
Sequence CLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLP SGKLQVHLRG
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Pig : 92%, Zebrafish : 92%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against MTX1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name MTX1
Background MTX1 belongs to the metaxin family. It is involved in transport of proteins into the mitochondrion and essential for embryonic development.
Molecular Weight 51kDa
Gene ID 4580
NCBI Accession NP_002446, NM_002455
UniProt Q13505
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-MTX1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Xie, Marusich, Souda et al.: "The mitochondrial inner membrane protein mitofilin exists as a complex with SAM50, metaxins 1 and 2, coiled-coil-helix coiled-coil-helix domain-containing protein 3 and 6 and DnaJC11." in: FEBS letters, Vol. 581, Issue 18, pp. 3545-9, 2007 (PubMed).

Alternatives for antigen "Metaxin 1 (MTX1)", type "Antibodies"
Hosts (7)
Reactivities (7), (2), (2)
Applications (6), (3), (2)
Epitopes (1)
Beacon