Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502692

Centromere Protein A (CENPA) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
CENP-A, CenH3, Cenp-A, RGD1563607, BcDNA:RE21270, CENP-A/CID, CENP-A/Cid, CENP-C, CENPA, CG13329, CID, CID/CENP-A, CenH3/CID, CenH3[CID], CenH3[Cid], CenpA, CenpA/CID, Cid, Cid[Mel], Dmel\\CG13329, ce ... show more
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502692
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CENPA antibody: synthetic peptide directed towards the middle region of human CENPA
Sequence ALQEAAEAFLVHLFEDAYLLTLHAGRVTLFPKDVQLARRI RGLEEGLG
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Rat : 100%, Mouse : 85%, Chicken : 84%, Zebrafish : 84%
Characteristics This is a rabbit polyclonal antibody against CENPA. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CENPA
Background Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA is a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle.Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. CENPA encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. CENPA is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Molecular Weight 16kDa
Gene ID 1058
NCBI Accession NP_001800, NM_001809
UniProt P49450
Research Area Chromatin and Nuclear Signaling, Cell Cycle
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CENPA antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Orthaus, Biskup, Hoffmann et al.: "Assembly of the inner kinetochore proteins CENP-A and CENP-B in living human cells." in: Chembiochem : a European journal of chemical biology, Vol. 9, Issue 1, pp. 77-92, 2007 (PubMed).

Alternatives for antigen "Centromere Protein A (CENPA)", type "Antibodies"
Hosts (57), (11), (3)
Reactivities (66), (13), (13), (12), (12), (12), (2)
Applications (40), (29), (20), (14), (14), (7), (5), (4), (2), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (18), (14), (3), (3), (3), (2), (2), (2), (1), (1), (1)
Beacon