Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2, Methenyltetrahydrofolate Cyclohydrolase (MTHFD2) antibody

Antigen

Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2, Methenyltetrahydrofolate Cyclohydrolase (MTHFD2)

Synonyms NMDMC, AW558851, MTHFD2, MGC78982, MGC130743, mthfd2, MGC82516, MGC142685, MGC91891, MGC174756, zgc:91891, wu:fb38b11, wu:fe12e11
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine), Xenopus laevis, Chicken

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502719
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name MTHFD2
Gene ID MTHFD2
UniProt P13995
Immunogen The immunogen for anti-MTHFD2 antibody: synthetic peptide directed towards the N terminal of human MTHFD2
Sequence EAVVISGRKLAQQIKQEVRQEVEEWVASGNKRPHLSVILV GENPASHSYV
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-MTHFD2 antibody concentration is 1 mg/ml.
Description MTHFD2 is a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD.This gene encodes a nuclear-encoded mitochondrial bifunctional enzyme with methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase activities. The enzyme functions as a homodimer and is unique in its absolute requirement for magnesium and inorganic phosphate. Formation of the enzyme-magnesium complex allows binding of NAD. Alternative splicing results in multiple transcripts encoding different isoforms. This gene has a pseudogene on chromosome 7.
Characteristics Antigen Size: 350 amino acids
Molecular Weight 35kDa

Application Details

Application Notes WB Suggested Anti-MTHFD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Signaling, Metabolism
Restrictions For Research Use only

Publications

Product Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives

Alternatives for antigen "Methylenetetrahydrofolate Dehydrogenase (NADP+ Dependent) 2, Methenyltetrahydrofolate Cyclohydrolase (MTHFD2)", type "Antibodies"
Hosts Rabbit (21), Mouse (2)
Reactivities Human (19), Mouse (Murine) (8), Rat (Rattus) (7), Chicken (4), Cow (Bovine) (4), Dog (Canine) (4), Xenopus laevis (3), Zebrafish (2), Cat (Feline) (1)
Applications Western Blotting (WB) (23), ELISA (14), Immunohistochemistry (IHC) (6), Immunofluorescence (IF) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1), Immunoprecipitation (IP) (1)
Epitopes N-Term (3), C-Term (2), Center (1), Internal Region (1)