Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Mitochondrial Ribosomal Protein L15 (MRPL15) antibody

Antigen

Mitochondrial Ribosomal Protein L15 (MRPL15)

Synonyms L15mt, RPML7, MRP-L7, HSPC145, MRP-L15
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken, Xenopus laevis, Zebrafish

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN502725
Quantity 50 µg  (Variants)
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name MRPL15
Gene ID MRPL15
UniProt Q9P015
Immunogen The immunogen for anti-MRPL15 antibody: synthetic peptide directed towards the C terminal of human MRPL15
Sequence KDELFKMLCTRKDPRQIFFGLAPGWVVNMADKKILKPTDE NLLKYYTS
Cross-Reactivity Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-MRPL15 antibody concentration is 1 mg/ml.
Description Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPL15 belongs to the ribosomal protein L15P family. It is a 39S subunit protein that belongs to the EcoL15 ribosomal protein family.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 39S subunit protein that belongs to the EcoL15 ribosomal protein family. A pseudogene corresponding to this gene is found on chromosome 15q.
Characteristics Antigen Size: 296 amino acids
Molecular Weight 33kDa

Application Details

Application Notes WB Suggested Anti-MRPL15 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Chromatin and Nuclear Signaling, DNA/RNA, Organelles
Restrictions For Research Use only

Publications

Product Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives

Alternatives for antigen "Mitochondrial Ribosomal Protein L15 (MRPL15)", type "Antibodies"
Hosts Rabbit (12)
Reactivities Human (10), Mouse (Murine) (6), Rat (Rattus) (5), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Western Blotting (WB) (12), ELISA (8), Immunohistochemistry (IHC) (3), Immunofluorescence (IF) (1), Immunoprecipitation (IP) (1)
Epitopes C-Term (1), Internal Region (1), N-Term (1)