Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1) (N-Term) antibody

Details for Product No. ABIN502766
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 30ST3B1, 3OST3B1, 3Ost3b, Hs3st3b, 3-OST-3B, AU041882, AW536289, m3-OST-3B
Epitope
N-Term
(1)
Reactivity
Dog (Canine), Cow (Bovine), Human
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2)
Pubmed 1 reference available
Catalog no. ABIN502766
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human HS3ST3B1
Sequence AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPAL ATAPDGTPPR
Predicted Reactivity Dog : 92 %, Horse : 92 %, Pig : 92 %, Bovine : 92 %
Characteristics This is a rabbit polyclonal antibody against HS3ST3B1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HS3ST3B1
Background HS3ST3B1 is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta.
Molecular Weight 43 kDa
Gene ID 9953
NCBI Accession NM_006041, NP_006032
UniProt Q9Y662
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 390 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Moon, Edavettal, Krahn et al.: "Structural analysis of the sulfotransferase (3-o-sulfotransferase isoform 3) involved in the biosynthesis of an entry receptor for herpes simplex virus 1." in: The Journal of biological chemistry, Vol. 279, Issue 43, pp. 45185-93, 2004 (PubMed).

Hosts (2)
Reactivities (1)
Applications (2)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top