Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1) antibody

Antigen: Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 3B1 (HS3ST3B1)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN502766

Additional Information

Alternative name: HS3ST3B1 / 3OST3B1

Gene ID: HS3ST3B1

UniProt: Q9Y662

Immunogen: The immunogen for anti-HS3ST3B1 antibody: synthetic peptide directed towards the N terminal of human HS3ST3B1

Sequence: AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPAL ATAPDGTPPR

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-HS3ST3B1 antibody concentration is 1 mg/ml.

Description: HS3ST3B1 is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta.

Characteristics: Antigen Size: 390 amino acids

Molecular Weight: 43kDa

Application Details

Application Notes: WB Suggested Anti-HS3ST3B1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-HS3ST3B1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle

Publications

Product: Moon, Edavettal, Krahn et al.: "Structural analysis of the sulfotransferase (3-o-sulfotransferase isoform 3) involved in the biosynthesis of an entry receptor for herpes simplex virus 1." in: The Journal of biological chemistry, Vol. 279, Issue 43, pp. 45185-93, 2004 (PubMed).