Microvascular Endothelial Differentiation Gene 1 Protein (DNAJB9) antibody

Antigen: Microvascular Endothelial Differentiation Gene 1 Protein (DNAJB9)

Synonyms: MDG1, ERdj4, MST049, MSTP049, DKFZp564F1862

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN502786

Additional Information

Alternative name: DNAJB9

Gene ID: DNAJB9

UniProt: Q9UBS3

Immunogen: The immunogen for anti-DNAJB9 antibody: synthetic peptide directed towards the N terminal of human DNAJB9

Sequence: MATPQSIFIFAICILMITELILASKSYYDILGVPKSASER QIKKAFHKLA

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-DNAJB9 antibody concentration is 1 mg/ml.

Description: DNAJB9 acts as a co-chaperone with an Hsp70 protein.

Characteristics: Antigen Size: 223 amino acids

Molecular Weight: 25kDa

Application Details

Application Notes: WB Suggested Anti-DNAJB9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-DNAJB9 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate

Publications

Product: Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).