Sushi Domain Containing 4 (SUSD4) antibody

Antigen: Sushi Domain Containing 4 (SUSD4)

Synonyms: PRO222, FLJ10052, RP11-239E10.4, N28096, AI848994, MGC30368, E430021N18Rik, RGD1564043, MGC143199, susd4, MGC146481, DKFZp469E106

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Mouse (Murine), Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN502832

Additional Information

Alternative name: SUSD4

Gene ID: SUSD4

UniProt: Q5VX71

Immunogen: The immunogen for anti-SUSD4 antibody: synthetic peptide directed towards the middle region of human SUSD4

Sequence: HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQ YGEWFPSYQV

Cross-Reactivity: Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SUSD4 antibody concentration is 1 mg/ml.

Description: SUSD4 contains 4 Sushi (CCP/SCR) domains. It is a single-pass type I membrane protein. The function of the SUSD4 protein remains unknown.

Characteristics: Antigen Size: 490 amino acids

Molecular Weight: 54kDa

Application Details

Application Notes: WB Suggested Anti-SUSD4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: PANC1 cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SUSD4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: PANC1 cell lysate

Publications

Product: Clark, Gurney, Abaya et al.: "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." in: Genome research, Vol. 13, Issue 10, pp. 2265-70, 2003 (PubMed).