SUSD4 antibody (Sushi Domain Containing 4) (Middle Region)

Details for Product anti-SUSD4 Antibody No. ABIN635458
Antigen
Epitope
Middle Region
4
3
2
1
1
Reactivity
Human, Mouse (Murine), Rat (Rattus)
13
4
4
3
3
3
2
2
1
1
1
1
1
Host
Rabbit
11
2
Clonality
Polyclonal
Conjugate
This SUSD4 antibody is un-conjugated
1
1
1
Application
Western Blotting (WB)
9
6
2
Options
Immunogen SUSD4 antibody was raised using the middle region of SUSD4 corresponding to a region with amino acids HGDFVCHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQV
Specificity SUSD4 antibody was raised against the middle region of SUSD4
Purification Affinity purified
Antigen
Alternative Name SUSD4
Background SUSD4 contains 4 Sushi (CCP/SCR) domains. It is a single-pass type I membrane protein. The function of the SUSD4 protein remains unknown.
Molecular Weight 54 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

SUSD4 Blocking Peptide, catalog no. 33R-3734, is also available for use as a blocking control in assays to test for specificity of this SUSD4 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUSD4 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Sushi Domain Containing 4 (SUSD4) (Middle Region) antibody (ABIN635458) SUSD4 antibody used at 1 ug/ml to detect target protein.