Did you know that you can buy products from over 140 different suppliers from us?

Forkhead Box R1 (FOXR1) (N-Term) antibody

Details for Product No. ABIN502894
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms foxn5, dlnb13, FOXN5, Foxn5, Gm1115
Epitope
N-Term
(2), (1)
Reactivity
Human
(7), (3)
Host
Rabbit
(7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (4)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502894
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FOXR1
Sequence KKPNPDKDGPDYEPNLWMWVNPNIVYPPGKLEVSGRRKRE DLTSTLPSSQ
Predicted Reactivity Guinea pig : 100 %, Human : 100 %
Characteristics This is a rabbit polyclonal antibody against FOXR1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FOXR1
Background FOXR1 is a member of the forkhead box (FOX) family of transcription factors. FOX family members are monomeric, helix-turn-helix proteins with a core DNA-binding domain of approximately 110 aa. Many FOX transcription factors play roles in determining cell fates during early development. This forkhead box protein lacks the C-terminal basic region found in many other FOX family members. It is located within the 11q23.3 region which is commonly deleted in neuroblastomas. This gene encodes a member of the forkhead box (FOX) family of transcription factors. FOX family members are monomeric, helix-turn-helix proteins with a core DNA-binding domain of approximately 110 aa. Many FOX transcription factors play roles in determining cell fates during early development. This forkhead box protein lacks the C-terminal basic region found in many other FOX family members. It is located within the 11q23.3 region which is commonly deleted in neuroblastomas.
Molecular Weight 33 kDa
Gene ID 283150
NCBI Accession NM_181721, NP_859072
UniProt Q6PIV2
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 292 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Katoh, Katoh: "Human FOX gene family (Review)." in: International journal of oncology, Vol. 25, Issue 5, pp. 1495-500, 2004 (PubMed).

Validation Images
back to top