Intraflagellar Transport 27 Homolog (Chlamydomonas) (IFT27) antibody

Antigen: Intraflagellar Transport 27 Homolog (Chlamydomonas) (IFT27)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN502931

Additional Information

Alternative name: RABL4 / IFT27

Gene ID: RABL4

UniProt: Q9BW83-2

Immunogen: The immunogen for anti-RABL4 antibody: synthetic peptide directed towards the C terminal of human RABL4

Sequence: RAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREK VEVFRALA

Cross-Reactivity: Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RABL4 antibody concentration is 1 mg/ml.

Description: RABL4 belongs to the small GTPase superfamily, Ras family. RABL4 possesses GTPase activity By similarity.This gene encodes a putative GTP-binding protein similar to RAY/RAB1C. The protein is ras-related, but the function is unknown.

Characteristics: Antigen Size: 185 amino acids

Molecular Weight: 20kDa

Application Details

Application Notes: WB Suggested Anti-RABL4 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RABL4 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate

Publications

Product: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).