Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502935

Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARSDR1, CGI82, HCBP12, MDT1, PSDR1, RALR1, SCALD, SDR7C1, 2610319N22Rik, AI428145, AU045252, Arsdr1, C85936, CGI-82, M42C60, Mdt1, Psdr1, UBE-1c1, Ube-1c, RDH11
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502935
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RDH11 antibody: synthetic peptide directed towards the C terminal of human RDH11
Sequence SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVS AQARNETIAR
Predicted Reactivity Human : 100%, Rabbit : 100%, Rat : 100%, Mouse : 91%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against RDH11. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RDH11
Background RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.
Molecular Weight 35kDa
Gene ID 51109
NCBI Accession NP_057110, NM_016026
UniProt Q8TC12
Research Area Signaling, Metabolism, Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RDH11 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Roni, Carpio, Wissinger: "Mapping of transcription start sites of human retina expressed genes." in: BMC genomics, Vol. 8, pp. 42, 2007 (PubMed).

Alternatives for antigen "Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11)", type "Antibodies"
Hosts (34), (4)
Reactivities (34), (17), (14), (12), (12)
Applications (28), (16), (10), (7), (2), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (5), (1), (1)
Beacon