Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11) (C-Term) antibody

Details for Product No. ABIN502935
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms ARSDR1, CGI82, HCBP12, MDT1, PSDR1, RALR1, SCALD, SDR7C1, 2610319N22Rik, AI428145, AU045252, Arsdr1, C85936, CGI-82, M42C60, Mdt1, Psdr1, UBE-1c1, Ube-1c, RDH11
Epitope
C-Term
(7), (4), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Cow (Bovine), Human
(31), (17), (14), (12), (12)
Host
Rabbit
(31), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(25), (14), (10), (7), (2), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN502935
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human RDH11
Sequence SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVS AQARNETIAR
Predicted Reactivity Human : 100 %, Rabbit : 100 %, Rat : 100 %, Mouse : 90 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against RDH11. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RDH11
Background RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.
Molecular Weight 35 kDa
Gene ID 51109
NCBI Accession NM_016026, NP_057110
UniProt Q8TC12
Research Area Signaling, Metabolism, Cancer
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 318 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Product cited in: Roni, Carpio, Wissinger: "Mapping of transcription start sites of human retina expressed genes." in: BMC genomics, Vol. 8, pp. 42, 2007 (PubMed).

Hosts (31), (4)
Reactivities (31), (17), (14), (12), (12)
Applications (25), (14), (10), (7), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (4), (1), (1)
back to top