Polymerase (RNA) III (DNA Directed) Polypeptide H (22.9kD) (POLR3H) antibody

Antigen: Polymerase (RNA) III (DNA Directed) Polypeptide H (22.9kD) (POLR3H)

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN502958

Additional Information

Alternative name: POLR3H

Gene ID: POLR3H

UniProt: B0QYH9

Immunogen: The immunogen for anti-POLR3H antibody: synthetic peptide directed towards the middle region of human POLR3H

Sequence: AHDLYMDTGEEIRFRVVDESFVDTSPTGPSSADATTSSEE LPKKEAPYTL

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-POLR3H antibody concentration is 1 mg/ml.

Description: POLR3H belongs to the eukaryotic RPB7/RPC8 RNA polymerase subunit family. DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. POLR3H is a specific peripheric component of RNA polymerase III which synthesizes small RNAs, such as 5S rRNA and tRNAs.

Characteristics: Antigen Size: 175 amino acids

Molecular Weight: 20kDa

Application Details

Application Notes: WB Suggested Anti-POLR3H Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Chromatin and Nuclear Signaling, Transcription Factors

Restrictions: For Research Use only

Images

WB Suggested Anti-POLR3H Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Muscle

Publications

Product: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).