Did you know that you can buy products from over 140 different suppliers from us?

2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 1 (OGFOD1) (Middle Region) antibody

Details for Product No. ABIN502988
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms tpa1, MGC145343, D63, wu:fc33b08, zgc:66379, TPA1, 4930415J21Rik, AA387199, AA939912, AW061076, mKIAA1612, RGD1308848
Epitope
Middle Region
(8), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
(29), (19), (11), (11), (11)
Host
Rabbit
(23), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(21), (9), (7), (5), (5), (4), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN502988
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human OGFOD1
Sequence GCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRD RETLKFVKHI
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against OGFOD1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name OGFOD1
Background The specific function of this protein remains unknown.
Molecular Weight 63 kDa
Gene ID 55239
NCBI Accession NM_018233, NP_060703
UniProt Q8N543
Research Area Metabolism, Amino Acids
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 542 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 1 (OGFOD1) (Middle Region) antibody WB Suggested Anti-OGFOD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: DU145 cell lysate
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Validation Images
back to top