Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN502988

2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 1 (OGFOD1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TPA1, AA387199, AA939912, AW061076, mKIAA1612, 4930415J21Rik, RGD1308848, D63, zgc:66379, wu:fc33b08, tpa1, MGC145343
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN502988
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-OGFOD1 antibody: synthetic peptide directed towards the middle region of human OGFOD1
Sequence GCEGWEPEYGGFTSYIAKGEDEELLTVNPESNSLALVYRD RETLKFVKHI
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 85%
Characteristics This is a rabbit polyclonal antibody against OGFOD1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name OGFOD1
Background The specific function of this protein remains unknown.
Molecular Weight 63kDa
Gene ID 55239
NCBI Accession NP_060703, NM_018233
UniProt Q8N543
Research Area Metabolism, Amino Acids
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-OGFOD1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "2-Oxoglutarate and Iron-Dependent Oxygenase Domain Containing 1 (OGFOD1)", type "Antibodies"
Hosts (22), (7)
Reactivities (28), (18), (11), (11), (11)
Applications (20), (9), (8), (5), (5), (4), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (2), (1)
Beacon