NIMA (Never In Mitosis Gene A)-Related Kinase 11 (NEK11) antibody

Antigen: NIMA (Never In Mitosis Gene A)-Related Kinase 11 (NEK11)

Synonyms: FLJ23495, 4932416N14Rik, nek11, MGC147549

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human, Rat (Rattus)

Application: Western Blotting (WB)

Catalog no.: ABIN502997

Additional Information

Alternative name: NEK11

Gene ID: NEK11

UniProt: Q8NG66

Immunogen: The immunogen for anti-NEK11 antibody: synthetic peptide directed towards the middle region of human NEK11

Sequence: KEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTK TITTMAEDMS

Cross-Reactivity: Human, Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-NEK11 antibody concentration is 1 mg/ml.

Description: NEK11 is a member of the never in mitosis gene A family of kinases. NEK11 localizes to the nucleoli, and may function with NEK2A in the S-phase checkpoint. It appears to play roles in DNA replication and response to genotoxic stress. NEK11 belongs to the NIMA family of kinases, which are involved in DNA replication and genotoxic stress responses (Noguchi et al., 2002 [PubMed 12154088]).[supplied by OMIM]. Sequence Note: removed 2 bases from the 3' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-2937 AB071996.1 1-2937

Characteristics: Antigen Size: 645 amino acids

Molecular Weight: 74kDa

Application Details

Application Notes: WB Suggested Anti-NEK11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling

Restrictions: For Research Use only

Images

WB Suggested Anti-NEK11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate

Publications

Product: Uhl, Liu, Drgon et al.: "Molecular genetics of successful smoking cessation: convergent genome-wide association study results." in: Archives of general psychiatry, Vol. 65, Issue 6, pp. 683-93, 2008 (PubMed).