Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503044

Transmembrane Protein 63C (TMEM63C) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C14orf171, 4932420N09, 9330187M14Rik, RGD1310207, DKFZp468A1211
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503044
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMEM63C antibody: synthetic peptide directed towards the middle region of human TMEM63C
Sequence EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPAS SPARHTYGTM
Predicted Reactivity Human : 100%, Rat : 100%, Bovine : 92%, Guinea pig : 92%, Horse : 92%, Pig : 92%, Rabbit : 92%, Dog : 85%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against TMEM63C. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMEM63C
Background The specific function of the protein remains unknown.
Molecular Weight 93kDa
Gene ID 57156
NCBI Accession NP_065164, NM_020431
UniProt Q9P1W3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMEM63°Cantibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Heilig, Eckenberg, Petit et al.: "The DNA sequence and analysis of human chromosome 14." in: Nature, Vol. 421, Issue 6923, pp. 601-7, 2003 (PubMed).

Alternatives for antigen "Transmembrane Protein 63C (TMEM63C)", type "Antibodies"
Hosts (2)
Reactivities (1)
Applications (2), (1)
Epitopes (1)
Beacon