Transmembrane Protein 63C (TMEM63C) (Middle Region) antibody

Details for Product No. ABIN503044
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C14orf171, 4932420N09, 9330187M14Rik, RGD1310207, DKFZp468A1211
Epitope
Middle Region
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2)
Pubmed 1 reference available
Catalog no. ABIN503044
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TMEM63C
Sequence EEEIQTVFDMEPSSTSSTPTSLLYVATVLQEPELNLTPAS SPARHTYGTM
Predicted Reactivity Human : 100 %, Rat : 100 %, Bovine : 90 %, Guinea pig : 90 %, Horse : 90 %, Pig : 90 %, Rabbit : 90 %, Dog : 80 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against TMEM63C. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TMEM63C
Background The specific function of the protein remains unknown.
Molecular Weight 93 kDa
Gene ID 57156
NCBI Accession NM_020431, NP_065164
UniProt Q9P1W3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 806 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transmembrane Protein 63C (TMEM63C) (Middle Region) antibody WB Suggested Anti-TMEM63C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: THP-1 cell lysate
Background publications Heilig, Eckenberg, Petit et al.: "The DNA sequence and analysis of human chromosome 14...." in: Nature, Vol. 421, Issue 6923, pp. 601-7, 2003 (PubMed).

Hosts (2)
Reactivities (1)
Applications (2)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top