Ganglioside-Induced Differentiation-Associated Protein 1-Like 1 (GDAP1L1) (N-Term) antibody

Details for Product No. ABIN503085
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms dJ881L22.1, dJ995J12.1.1, Gdap1l, GDAP1L1, MGC146673
Epitope
N-Term
(1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human
(10), (3), (2)
Host
Rabbit
(6), (5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(11), (5), (3), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN503085
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human GDAP1L1
Sequence ERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQ IIDYVERTFT
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against GDAP1L1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GDAP1L1
Background The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1). A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. GDAP1L1 is similar in sequence to the human GDAP1 protein.The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1). A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. The protein encoded by this gene is similar in sequence to the human GDAP1 protein.
Molecular Weight 42 kDa
Gene ID 78997
NCBI Accession NM_024034, NP_076939
UniProt Q96MZ0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 367 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Deloukas, Matthews, Ashurst et al.: "The DNA sequence and comparative analysis of human chromosome 20." in: Nature, Vol. 414, Issue 6866, pp. 865-71, 2002 (PubMed).

Hosts (6), (5)
Reactivities (10), (3), (2)
Applications (11), (5), (3), (3), (2)
Epitopes (1), (1)
back to top