Did you know that you can buy products from over 140 different suppliers from us?

Lens Intrinsic Membrane Protein 2, 19kDa (LIM2) (N-Term) antibody

Details for Product No. ABIN503108
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 19kDa, 4833403J20, MP19, To3, MP20, Mp19, CTRCT19, MP17
Epitope
N-Term
(9), (8), (2), (1)
Reactivity
Human
(12)
Host
Rabbit
(12), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (7), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503108
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human LIM2
Sequence GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSR ADLGAQGHLY
Predicted Reactivity Human
Characteristics This is a rabbit polyclonal antibody against LIM2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LIM2
Background This gene encodes an eye lens-specific protein found at the junctions of lens fiber cells, where it may contribute to cell junctional organization. It acts as a receptor for calmodulin, and may play an important role in both lens development and cataracto
Molecular Weight 24 kDa
Gene ID 3982
NCBI Accession NM_030657, NP_085915
UniProt P55344-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 215 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Lens Intrinsic Membrane Protein 2, 19kDa (LIM2) (N-Term) antibody WB Suggested Anti-LIM2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: COLO205 cell lysate
Product cited in: Wistow, Bernstein, Wyatt et al.: "Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants." in: Molecular vision, Vol. 8, pp. 171-84, 2002 (PubMed).

Background publications Ko, Kay: "Differential interaction of molecular chaperones with procollagen I and type IV collagen in corneal endothelial cells." in: Molecular vision, Vol. 8, pp. 1-9, 2002 (PubMed).

Validation Images
back to top