Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 429 (ZNF429) (N-Term) antibody

Details for Product No. ABIN503144
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(7), (7), (1), (1)
Reactivity
Human
(10)
Host
Rabbit
(10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (6)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503144
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF429
Sequence KMYHCDIYVKVFYAFSNADRYKTRHTGKKPFQCKKCGKSF CMLSQLTQHK
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against ZNF429. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF429
Background ZNF429 may be involved in transcriptional regulation.
Molecular Weight 78 kDa
Gene ID 353088
NCBI Accession NM_001001415, NP_001001415
UniProt Q86V71
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 674 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 429 (ZNF429) (N-Term) antibody WB Suggested Anti-ZNF429 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Abrink, Aveskogh, Hellman: "Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937." in: DNA and cell biology, Vol. 14, Issue 2, pp. 125-36, 1995 (PubMed).

Hosts (10)
Reactivities (10)
Applications (10), (6)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (7), (7), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503144
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top