Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503144

Zinc Finger Protein 429 (ZNF429) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503144
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF429 antibody: synthetic peptide directed towards the N terminal of human ZNF429
Sequence KMYHCDIYVKVFYAFSNADRYKTRHTGKKPFQCKKCGKSF CMLSQLTQHK
Predicted Reactivity Human :100%,  
Characteristics This is a rabbit polyclonal antibody against ZNF429. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF429
Background ZNF429 may be involved in transcriptional regulation.
Molecular Weight 78kDa
Gene ID 353088
NCBI Accession NP_001001415, NM_001001415
UniProt Q86V71
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF429 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Abrink, Aveskogh, Hellman: "Isolation of cDNA clones for 42 different Krüppel-related zinc finger proteins expressed in the human monoblast cell line U-937." in: DNA and cell biology, Vol. 14, Issue 2, pp. 125-36, 1995 (PubMed).

Alternatives for antigen "Zinc Finger Protein 429 (ZNF429)", type "Antibodies"
Hosts (5)
Reactivities (5)
Applications (5)
Epitopes (3), (2), (1), (1)
Beacon