Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 833 (ZNF833) (N-Term) antibody

Details for Product No. ABIN503150
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF833
Epitope
N-Term
(1)
Reactivity
Human
(1), (1), (1), (1)
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503150
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human LOC401898
Sequence MVMHSEDEPYKCKFCGKAFDNLHLYLTHERTHTGEKPYEC NKCGKAFSCS
Predicted Reactivity Human :100 %,  
Characteristics This is a rabbit polyclonal antibody against LOC401898. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF833P
Background The exact function ofLOC401898 remains unknown.
Molecular Weight 22 kDa
Gene ID 401898
NCBI Accession NM_001013691, NP_001013713
UniProt Q6ZTB9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 187 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 833 (ZNF833) (N-Term) antibody WB Suggested Anti-ZNF833P Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Intestine
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Hosts (1)
Reactivities (1), (1), (1), (1)
Applications (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503150
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top