Did you know that you can buy products from over 140 different suppliers from us?

PHD Finger Protein 20-Like 1 (PHF20L1) (N-Term) antibody

Details for Product No. ABIN503181
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TDRD20B, CGI-72, E130113K22Rik
Epitope
N-Term
(8), (7), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(15)
Host
Rabbit
(14), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (9), (3), (1), (1)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503181
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PHF20L1
Sequence AAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTC IATPDVEKKE
Predicted Reactivity Human : 100 %, Pig : 90 %, Rabbit : 90 %, Chicken : 90 %, Dog : 80 %, Horse : 80 %, Mouse : 70 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against PHF20L1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PHF20L1
Background The exact function of PHF20L1 remains unknown.
Molecular Weight 63 kDa
Gene ID 51105
NCBI Accession NM_032205, NP_115581
UniProt A8MW92
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 573 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-PHD Finger Protein 20-Like 1 (PHF20L1) (N-Term) antibody WB Suggested Anti-PHF20L1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Validation Images
back to top