Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503181

PHD Finger Protein 20-Like 1 (PHF20L1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TDRD20B, CGI-72, E130113K22Rik
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN503181
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PHF20L1 antibody: synthetic peptide directed towards the N terminal of human PHF20L1
Sequence AAKNKTGSKPRTSANSNKDKDKDERKWFKVPSKKEETSTC IATPDVEKKE
Predicted Reactivity Human : 100%, Pig : 92%, Rabbit : 92%, Chicken : 90%, Dog : 85%, Horse : 85%, Mouse : 76%, Rat : 76%
Characteristics This is a rabbit polyclonal antibody against PHF20L1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PHF20L1
Background The exact function of PHF20L1 remains unknown.
Molecular Weight 63kDa
Gene ID 51105
NCBI Accession NP_115581, NM_032205
UniProt A8MW92
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PHF20L1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "PHD Finger Protein 20-Like 1 (PHF20L1)", type "Antibodies"
Hosts (7), (2)
Reactivities (9)
Applications (9), (3), (2), (2), (1), (1)
Epitopes (3), (2), (1), (1), (1), (1)
Beacon