Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503185

SET and MYND Domain Containing 4 (SMYD4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZMYND21, G430029E23Rik
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN503185
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SMYD4 antibody: synthetic peptide directed towards the N terminal of human SMYD4
Sequence EGNKKFQEKDYTGAAVLYSKGVSHSRPNTEDMSLCHANRS AALFHLGQYE
Predicted Reactivity Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Rabbit : 92%, Pig : 85%, Dog : 84%
Characteristics This is a rabbit polyclonal antibody against SMYD4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SMYD4
Background The exact function of SMYD4 remains unknown.
Molecular Weight 89kDa
Gene ID 114826
NCBI Accession NP_443160, NM_052928
UniProt Q8IYR2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SMYD4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Kimura, Wakamatsu, Suzuki et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Alternatives for antigen "SET and MYND Domain Containing 4 (SMYD4)", type "Antibodies"
Hosts (9), (2)
Reactivities (11), (2), (2)
Applications (11), (6), (6), (3), (1)
Epitopes (4), (2), (2), (1)
Beacon