Integrator Complex Subunit 12 (INTS12) antibody

Antigen: Integrator Complex Subunit 12 (INTS12)

Synonyms: INT12, PHF22, SBBI22, GB14117, fi17f05, zgc:86602, wu:fi17f05, NV50096

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN503217

Additional Information

Alternative name: INTS12 / PHF22

Gene ID: INTS12

UniProt: Q96CB8

Immunogen: The immunogen for anti-INTS12 antibody: synthetic peptide directed towards the N terminal of human INTS12

Sequence: DESLARGIDSSYRPSQKDVEPPKISSTKNISIKQEPKISS SLPSGNNNGK

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-INTS12 antibody concentration is 1 mg/ml.

Description: INTS12 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1) and U2 (RNU2).INTS12 is a subunit of the Integrator complex, which associates with the C-terminal domain of RNA polymerase II large subunit (POLR2A, MIM 180660) and mediates 3-prime end processing of small nuclear RNAs U1 (RNU1, MIM 180680) and U2 (RNU2, MIM 180690) (Baillat et al., 2005 [PubMed 16239144]).[supplied by OMIM].

Characteristics: Antigen Size: 462 amino acids

Molecular Weight: 49kDa

Application Details

Application Notes: WB Suggested Anti-INTS12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-INTS12 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver

Publications

Product: Baillat, Hakimi, Näär et al.: "Integrator, a multiprotein mediator of small nuclear RNA processing, associates with the C-terminal repeat of RNA polymerase II." in: Cell, Vol. 123, Issue 2, pp. 265-76, 2005 (PubMed).