Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503276

Family with Sequence Similarity 54, Member A (FAM54A) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DUFD1, FAM54A, 2610016C23Rik, 4933412C16Rik, Dufd1, Fam54a
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503276
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAM54A antibody: synthetic peptide directed towards the middle region of human FAM54A
Sequence NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPG GRPIHKRKRQ
Predicted Reactivity Human : 100%, Bovine : 84%, Rabbit : 83%
Characteristics This is a rabbit polyclonal antibody against FAM54A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAM54A
Background FAM54A belongs to the MTFR1/FAM54 family. The function of the FAM54A protein is not known.
Molecular Weight 43kDa
Gene ID 113115
NCBI Accession NP_001092756, NM_001099286
UniProt Q6P444
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAM54A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Alternatives for antigen "Family with Sequence Similarity 54, Member A (FAM54A)", type "Antibodies"
Hosts (4)
Reactivities (3)
Applications (4), (1)
Epitopes (2), (1)
Beacon