Family with Sequence Similarity 54, Member A (FAM54A) (Middle Region) antibody

Details for Product No. ABIN503276
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DUFD1, FAM54A, 2610016C23Rik, 4933412C16Rik, Dufd1, Fam54a
Epitope
Middle Region
(3), (1), (1)
Reactivity
Cow (Bovine), Human
(4)
Host
Rabbit
(5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5)
Pubmed 1 reference available
Catalog no. ABIN503276
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human FAM54A
Sequence NKTNYSHHSKSQRNKDIPNMLDVLKDMNKVKLRAIERSPG GRPIHKRKRQ
Predicted Reactivity Human : 100 %, Bovine : 80 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against FAM54A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name FAM54A
Background FAM54A belongs to the MTFR1/FAM54 family. The function of the FAM54A protein is not known.
Molecular Weight 43 kDa
Gene ID 113115
NCBI Accession NM_001099286, NP_001092756
UniProt Q6P444
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 385 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Family with Sequence Similarity 54, Member A (FAM54A) (Middle Region) antibody WB Suggested Anti-FAM54A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: Human Muscle
Background publications Mungall, Palmer, Sims et al.: "The DNA sequence and analysis of human chromosome 6...." in: Nature, Vol. 425, Issue 6960, pp. 805-11, 2003 (PubMed).

Hosts (5)
Reactivities (4)
Applications (5)
Epitopes (3), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top