Solute Carrier Family 47, Member 2 (SLC47A2) antibody

Antigen: Solute Carrier Family 47, Member 2 (SLC47A2)

Synonyms: MATE2, MATE2K, MATE2-B, MATE2-K, FLJ31196, 4933429E10Rik, RGD1562382, SLC47A2, DKFZp469G161

Clonality: Polyclonal

Host: Rabbit

Reactivity: Dog (Canine), Human

Application: Western Blotting (WB)

Catalog no.: ABIN503277

Additional Information

Alternative name: SLC47A2

Gene ID: SLC47A2

UniProt: Q86VL8-3

Immunogen: The immunogen for anti-SLC47A2 antibody: synthetic peptide directed towards the C terminal of human SLC47A2

Sequence: TYSRSECHVDFFRTPEEAHALSAPTSRLSVKQLVIRRGAA LGAASATLMV

Cross-Reactivity: Dog (Canine), Human

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-SLC47A2 antibody concentration is 1 mg/ml.

Description: SLC47A2 is a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance.This gene encodes a protein belonging to a family of transporters involved in excretion of toxic electrolytes, both endogenous and exogenous, through urine and bile. This transporter family shares homology with the bacterial MATE (multidrug and toxin extrusion) protein family responsible for drug resistance. This gene is one of two members of the MATE transporter family located near each other on chromosome 17. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Characteristics: Antigen Size: 566 amino acids

Molecular Weight: 61kDa

Application Details

Application Notes: WB Suggested Anti-SLC47A2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Human Lung.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-SLC47A2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:2500
Positive Control: Human Lung

Publications

Product: Tanihara, Masuda, Sato et al.: "Substrate specificity of MATE1 and MATE2-K, human multidrug and toxin extrusions/H(+)-organic cation antiporters." in: Biochemical pharmacology, Vol. 74, Issue 2, pp. 359-71, 2007 (PubMed).