Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1) antibody

Antigen

Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1)

Synonyms EIF2B, EIF2BA, MGC117409, MGC125868, MGC125869, eIF-2a, 26kDa, MGC6458, D5Ertd406e, EIF2B1, DKFZp469L0133
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)

Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503287
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name EIF2B1 / EIF2BA
Gene ID EIF2B1
UniProt Q14232
Immunogen The immunogen for anti-EIF2B1 antibody: synthetic peptide directed towards the C terminal of human EIF2B1
Sequence ADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTP SAVSDELIKL
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-EIF2B1 antibody concentration is 1 mg/ml.
Description EIF2B1 belongs to the EIF-2B alpha/beta/delta subunits family. It catalyzes the exchange of eukaryotic initiation factor 2-bound GDP for GTP. Defects in EIF2B1 are a cause of leukoencephalopathy with vanishing white matter (VWM).
Characteristics Antigen Size: 305 amino acids
Molecular Weight 34kDa

Application Details

Application Notes WB Suggested Anti-EIF2B1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications

Product Maletkovic, Schiffmann, Gorospe et al.: "Genetic and clinical heterogeneity in eIF2B-related disorder." in: Journal of child neurology, Vol. 23, Issue 2, pp. 205-15, 2008 (PubMed).

Alternatives

Alternatives for antigen "Eukaryotic Translation Initiation Factor 2B, Subunit 1 Alpha, 26kDa (EIF2B1)", type "Antibodies"
Hosts Rabbit (8), Mouse (1)
Reactivities Human (8), Mouse (Murine) (4), Rat (Rattus) (3), Cat (Feline) (1), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1)
Applications Western Blotting (WB) (8), ELISA (7), Immunohistochemistry (IHC) (2), Immunofluorescence (IF) (1), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (1), Immunoprecipitation (IP) (1)
Epitopes AA 1-305 (1), C-Term (1), Center (1)