Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Casein Kinase 1, delta (CSNK1D) antibody

Antigen

Casein Kinase 1, delta (CSNK1D)
Synonyms HCKID, AA409348, 1200006A05Rik, D930010H05Rik, MGC75636, CKId, csnk1d, CKI-delta, zgc:77627, wu:fb69b03, wu:fj97a05, CSNK1D, MGC166392, DKFZp459O1232, ckIdelta, MGC53415
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503292
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Casein Kinase 1, delta (CSNK1D) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name Casein kinase I delta
Gene ID CSNK1D
UniProt P48730
Immunogen The immunogen for anti-CSNK1D antibody: synthetic peptide directed towards the middle region of human CSNK1D
Sequence NLVYIIDFGLAKKYRDARTHQHIPYRENKNLTGTARYASI NTHLGIEQSR
Cross-Reactivity Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-CSNK1D antibody concentration is 1 mg/ml.
Description This gene is a member of the casein kinase I (CKI) gene family whose members have been implicated in the control of cytoplasmic and nuclear processes, including DNA replication and repair. The encoded protein is highly similar to the mouse and rat CK1 del
Characteristics Antigen Size: 415 amino acids
Molecular Weight 47kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-CSNK1D Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: OVCAR-3 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Kinases/Phosphatases
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Meng, Logunova, Maywood et al.: "Setting clock speed in mammals: the CK1 epsilon tau mutation in mice accelerates circadian pacemakers by selectively destabilizing PERIOD proteins." in: Neuron, Vol. 58, Issue 1, pp. 78-88, 2008 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Casein Kinase 1, delta (CSNK1D)", type "Antibodies"
Hosts Rabbit (27), Goat (8), Mouse (1), Sheep (1)
Reactivities Human (35), Mouse (Murine) (23), Rat (Rattus) (22), Dog (Canine) (20), Chicken (18), Cow (Bovine) (18), Horse (Equine) (17), Pig (Porcine) (17), Sheep (Ovine) (17), Cat (Feline) (1)
Applications ELISA (19), Immunofluorescence (IF) (18), Western Blotting (WB) (17), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (9), Immunohistochemistry (IHC) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoelectron Microscopy (IEM) (1), Immunoprecipitation (IP) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (5), Internal Region (2), AA 310-327 (1), Center (1)