Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503362

IQ Motif Containing D (IQCD) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI662646, 4933433C09Rik
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503362
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-IQCD antibody: synthetic peptide directed towards the N terminal of human IQCD
Sequence ALDILAMAPLYQAPAINRIGPKTDPSKRPADPLKPLVLSR TKLTTIEAKR
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against IQCD. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name IQCD
Background IQCD contains 1 IQ domain. The function of the IQCD protein is not known.
Molecular Weight 40kDa
Gene ID 115811
NCBI Accession NP_612460, NM_138451
UniProt Q96DY2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-IQCD antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Muzny, Buhay et al.: "The finished DNA sequence of human chromosome 12." in: Nature, Vol. 440, Issue 7082, pp. 346-51, 2006 (PubMed).

Alternatives for antigen "IQ Motif Containing D (IQCD)", type "Antibodies"
Hosts (8), (2)
Reactivities (8)
Applications (9), (3), (2), (2), (1)
Epitopes (2), (1), (1), (1), (1)
Beacon