Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503377

Tektin 4 (TEKT4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1700010L19Rik, Tek4, Tektin4, RGD1308075
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503377
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TEKT4 antibody: synthetic peptide directed towards the N terminal of human TEKT4
Sequence LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEA LAAETNLLLA
Predicted Reactivity Human : 100%, Bovine : 92%, Guinea pig : 91%, Mouse : 85%
Characteristics This is a rabbit polyclonal antibody against TEKT4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TEKT4
Background TEKT4 belongs to the tektin family.TEKT4 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules.
Molecular Weight 51kDa
Gene ID 150483
NCBI Accession NP_653306, NM_144705
UniProt Q8WW24
Research Area Reproduction, Cytoskeleton
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TEKT4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "Tektin 4 (TEKT4)", type "Antibodies"
Hosts (11), (1)
Reactivities (10), (6), (3), (1), (1)
Applications (11), (3), (2), (1)
Epitopes (3), (2), (1), (1), (1), (1)
Beacon