Did you know that you can buy products from over 140 different suppliers from us?

Tektin 4 (TEKT4) (N-Term) antibody

Details for Product No. ABIN503377
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1700010L19Rik, RGD1308075, Tek4, Tektin4
Epitope
N-Term
(7), (6), (3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Cow (Bovine), Human
(16), (5), (3), (1), (1)
Host
Rabbit
(17), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (8), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503377
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TEKT4
Sequence LATETQALAQRTQQDSTRTVGERLQDTHSWKSELQREMEA LAAETNLLLA
Predicted Reactivity Human : 100 %, Bovine : 90 %, Guinea pig : 90 %, Mouse : 80 %
Characteristics This is a rabbit polyclonal antibody against TEKT4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TEKT4
Background TEKT4 belongs to the tektin family.TEKT4 is a structural component of ciliary and flagellar microtubules. It forms filamentous polymers in the walls of ciliary and flagellar microtubules.
Molecular Weight 51 kDa
Gene ID 150483
NCBI Accession NM_144705, NP_653306
UniProt Q8WW24
Research Area Reproduction, Cytoskeleton
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 435 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tektin 4 (TEKT4) (N-Term) antibody WB Suggested Anti-TEKT4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: HepG2 cell lysate
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Validation Images
back to top