Did you know that you can buy products from over 140 different suppliers from us?

Nucleoredoxin-Like 2 (NXNL2) (Middle Region) antibody

Details for Product No. ABIN503389
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4930519N16Rik, Rdcvf2, C9orf121, RDCVF2
Epitope
Middle Region
(8), (7), (5), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(16), (3), (1), (1)
Host
Rabbit
(10), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (10), (7), (6), (5), (4)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503389
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human NXNL2
Sequence SADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRL ECSGVILAHC
Predicted Reactivity Human : 100 %, Bovine : 90 %, Horse : 90 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against NXNL2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NXNL2
Background The specific function of the protein remains unknown.
Molecular Weight 15 kDa
Gene ID 158046
NCBI Accession NM_145283, NP_660326
UniProt C9J7Y0
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 135 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nucleoredoxin-Like 2 (NXNL2) (Middle Region) antibody WB Suggested Anti-NXNL2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503389
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top