Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503389

Nucleoredoxin-Like 2 (NXNL2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4930519N16Rik, Rdcvf2, C9orf121, RDCVF2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503389
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NXNL2 antibody: synthetic peptide directed towards the middle region of human NXNL2
Sequence SADGSCQEMLDFMRELHGAWLALPFHDPYRQRSLALLPRL ECSGVILAHC
Predicted Reactivity Human : 100%, Bovine : 90%, Horse : 90%, Mouse : 90%, Rat : 90%
Characteristics This is a rabbit polyclonal antibody against NXNL2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NXNL2
Background The specific function of the protein remains unknown.
Molecular Weight 15kDa
Gene ID 158046
NCBI Accession NP_660326, NM_145283
UniProt C9J7Y0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NXNL2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Humphray, Oliver, Hunt et al.: "DNA sequence and analysis of human chromosome 9." in: Nature, Vol. 429, Issue 6990, pp. 369-74, 2004 (PubMed).

Alternatives for antigen "Nucleoredoxin-Like 2 (NXNL2)", type "Antibodies"
Hosts (7), (6)
Reactivities (12), (4), (3), (1)
Applications (9), (7), (6), (5), (4), (1)
Epitopes (5), (2), (2), (2), (1), (1)
Beacon