Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503421

Coiled-Coil Domain Containing 63 (CCDC63) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 4921511C16Rik, ODA5
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503421
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CCDC63 antibody: synthetic peptide directed towards the middle region of human CCDC63
Sequence IEDFLAKEEKNFARFTYVTELNNDMEMMHKRTQRIQDEII LLRSQQKLSH
Predicted Reactivity Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against CCDC63. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CCDC63
Background The specific function of this protein remains unknown.
Molecular Weight 66kDa
Gene ID 160762
NCBI Accession NP_689804, NM_152591
UniProt Q8NA47
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CCDC63 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Coiled-Coil Domain Containing 63 (CCDC63)", type "Antibodies"
Hosts (9)
Reactivities (7), (1), (1), (1)
Applications (9), (4), (1)
Epitopes (4), (2), (2), (2), (1)
Beacon