Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503429

RWD Domain Containing 4 (RWDD4) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FAM28A, RWDD4A, BC016198, Gm1942, Rwdd4, Rwdd4a, fam28a, rwdd4a
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503429
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RWDD4A antibody: synthetic peptide directed towards the N terminal of human RWDD4A
Sequence MSANEDQEMELEALRSIYEGDESFRELSPVSFQYRIGENG DPKAFLIEIS
Predicted Reactivity Rat :100%,   Human :100%,   Mouse :100%,   Dog :100%,   Chicken :100%,   Bovine :100%,   Channel catfish :84%,   Atlantic salmon :84%,   Zebrafish :76%,   Green puffer :76%,  
Characteristics This is a rabbit polyclonal antibody against RWDD4A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RWDD4A
Background The specific function of this protein remains unknown.
Molecular Weight 21kDa
Gene ID 201965
NCBI Accession NP_689895, NM_152682
UniProt Q6NW29
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RWDD4A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hillier, Graves, Fulton et al.: "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." in: Nature, Vol. 434, Issue 7034, pp. 724-31, 2005 (PubMed).

Alternatives for antigen "RWD Domain Containing 4 (RWDD4)", type "Antibodies"
Hosts (6)
Reactivities (3), (2), (1), (1), (1), (1), (1)
Applications (6)
Epitopes (1), (1), (1), (1)
Beacon