Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503447

Transmembrane Protease, serine 6 (TMPRSS6) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1300008A22Rik, IRIDA
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN503447
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TMPRSS6 antibody: synthetic peptide directed towards the N terminal of human TMPRSS6
Sequence LLWYFLGYKAEVMVSQVYSGSLRVLNRHFSQDLTRRESSA FRSETAKAQK
Predicted Reactivity Human : 100%, Rat : 100%, Dog : 92%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against TMPRSS6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TMPRSS6
Background TMPRSS6 is a serine protease which hydrolyzes a range of proteins including type I collagen, fibronectin and fibrinogen. TMPRSS6 can also activate urokinase-type plasminogen activator with low efficiency. TMPRSS6 may play a specialized role in matrix remodeling processes in liver. TMPRSS6 is required to sense iron deficiency. Overexpression of TMPRSS6 suppresses activation of the HAMP promoter.The protein encoded by this gene is a type II transmembrane serine proteinase that is found attached to the cell surface. The encoded protein may be involved in matrix remodeling processes in the liver.
Molecular Weight 90kDa
Gene ID 164656
NCBI Accession NP_705837, NM_153609
UniProt Q8IU80
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TMPRSS6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Finberg, Heeney, Campagna et al.: "Mutations in TMPRSS6 cause iron-refractory iron deficiency anemia (IRIDA)." in: Nature genetics, Vol. 40, Issue 5, pp. 569-71, 2008 (PubMed).

Alternatives for antigen "Transmembrane Protease, serine 6 (TMPRSS6)", type "Antibodies"
Hosts (23), (1)
Reactivities (23), (19), (19), (17), (17), (17)
Applications (15), (10), (10), (5), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (1), (1), (1)
Beacon