Did you know that you can buy products from over 140 different suppliers from us?

Sideroflexin 4 (SFXN4) (C-Term) antibody

Details for Product No. ABIN503482
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms im:7151335, si:ch211-117n7.3, zgc:153199, BCRM1
Epitope
C-Term
(5), (1), (1)
Reactivity
Mouse (Murine), Human
(16)
Host
Rabbit
(17)
Clonality
Polyclonal
Application
Western Blotting (WB)
(17), (8), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503482
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human SFXN4
Sequence SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEET EIFYHRGV
Predicted Reactivity Human : 100 %, Mouse : 80 %
Characteristics This is a rabbit polyclonal antibody against SFXN4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SFXN4
Background SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter.
Molecular Weight 38 kDa
Gene ID 119559
NCBI Accession NM_213649, NP_998814
UniProt Q6P4A7
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 337 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Sideroflexin 4 (SFXN4) (C-Term) antibody WB Suggested Anti-SFXN4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: MCF7 cell lysate
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Validation Images
back to top