Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503482

Sideroflexin 4 (SFXN4) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BCRM1, im:7151335, si:ch211-117n7.3, zgc:153199
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503482
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SFXN4 antibody: synthetic peptide directed towards the C terminal of human SFXN4
Sequence SCTVLAMGLMVPFSFSIFPQIGQIQYCSLEEKIQSPTEET EIFYHRGV
Predicted Reactivity Human : 100%, Mouse : 84%
Characteristics This is a rabbit polyclonal antibody against SFXN4. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SFXN4
Background SFXN4 is a multi-pass membrane protein. It belongs to the sideroflexin family. SFXN4 is a potential iron transporter.
Molecular Weight 38kDa
Gene ID 119559
NCBI Accession NP_998814, NM_213649
UniProt Q6P4A7
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SFXN4 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives for antigen "Sideroflexin 4 (SFXN4)", type "Antibodies"
Hosts (12)
Reactivities (11)
Applications (12), (6)
Epitopes (3), (1)
Beacon