Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads) (N-Term) antibody

Details for Product No. ABIN503505
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AI196007, Bcd-1, Bcd1, Hdlq8, SCAD, ACAD3, Scad, zgc:92400, wu:fc44c01, acad3, scad, ACADS
Epitope
N-Term
(2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Pig (Porcine), Human, Chicken
(32), (20), (19), (13), (12), (12), (12), (1), (1)
Host
Rabbit
(32), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(25), (10), (8), (7), (6), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN503505
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ACADS
Sequence ASTGVIMSVNNSLYLGPILKFGSKEQKQAWVTPFTSGDKI GCFALSEPGN
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, African clawed frog : 90 %, Guinea pig : 90 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against ACADS. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ACADS
Background ACADS is a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency.This gene encodes a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency.
Molecular Weight 42 kDa
Gene ID 35
NCBI Accession NM_000017, NP_000008
UniProt P16219
Research Area Cancer, Fatty Acids, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 412 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads) (N-Term) antibody WB Suggested Anti-ACADS Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:500
Positive Control: 721_B cell lysate
Background publications Tein, Elpeleg, Ben-Zeev et al.: "Short-chain acyl-CoA dehydrogenase gene mutation (c.319C>T) presents with clinical heterogeneity and is candidate founder mutation in individuals of Ashkenazi Jewish origin." in: Molecular genetics and metabolism, Vol. 93, Issue 2, pp. 179-89, 2008 (PubMed).

Hosts (32), (3)
Reactivities (32), (20), (19), (13), (12), (12), (12), (1), (1)
Applications (25), (10), (8), (7), (6), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top