Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503622

NODAL Modulator 1 (NOMO1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PM5, Nomo, D7Ertd156e, pM5, RGD1305240, NOMO2, DKFZP459L1733
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503622
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NOMO1 antibody: synthetic peptide directed towards the N terminal of human NOMO1
Sequence DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLA DIIATGFSVC
Predicted Reactivity Human : 100%, Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against NOMO1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NOMO1
Background NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE). This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).
Molecular Weight 134kDa
Gene ID 23420
NCBI Accession NP_055102, NM_014287
UniProt P69849
Research Area Embryogenesis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NOMO1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Alternatives for antigen "NODAL Modulator 1 (NOMO1)", type "Antibodies"
Hosts (33), (2)
Reactivities (33), (20), (20), (17), (17), (17), (17), (1)
Applications (15), (12), (11), (10), (4), (4), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (1), (1)
Beacon