NODAL Modulator 1 (NOMO1) (N-Term) antibody

Details for Product No. ABIN503622
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PM5, Nomo, D7Ertd156e, pM5, RGD1305240, NOMO2, DKFZP459L1733
Epitope
N-Term
(4), (3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Human
(33), (21), (21), (17), (17), (17), (17), (1)
Host
Rabbit
(33), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (12), (10), (9), (4), (3), (3)
Pubmed 1 reference available
Catalog no. ABIN503622
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NOMO1
Sequence DGSFRLENITTGTYTIHAQKEHLYFETVTIKIAPNTPQLA DIIATGFSVC
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against NOMO1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NOMO1
Background NOMO1 was originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE). This gene encodes a protein originally thought to be related to the collagenase gene family. This gene is one of three highly similar genes in a region of duplication located on the p arm of chromosome 16. These three genes encode closely related proteins that may have the same function. The protein encoded by one of these genes has been identified as part of a protein complex that participates in the Nodal signaling pathway during vertebrate development. Mutations in ABCC6, which is located nearby, rather than mutations in this gene are associated with pseudoxanthoma elasticum (PXE).
Molecular Weight 134 kDa
Gene ID 23420
NCBI Accession NM_014287, NP_055102
UniProt P69849
Research Area Embryogenesis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1222 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-NODAL Modulator 1 (NOMO1) (N-Term) antibody WB Suggested Anti-NOMO1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
Background publications Lim, Hao, Shaw et al.: "A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration." in: Cell, Vol. 125, Issue 4, pp. 801-14, 2006 (PubMed).

Hosts (33), (2)
Reactivities (33), (21), (21), (17), (17), (17), (17), (1)
Applications (15), (12), (10), (9), (4), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top