Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503657

Centrosomal Protein 170B (CEP170B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CEP170R, FAM68C, KIAA0284, AI466840, AW555464, Kiaa0284, mKIAA0284, kiaa0284
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503657
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KIAA0284 antibody: synthetic peptide directed towards the n terminal of human KIAA0284
Sequence QLTKARKQEEDDSLSDAGTYTIETEAQDTEVEEARKMIDQ VFGVLESPEL
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Pig : 100%, Dog : 92%, Guinea pig : 91%
Characteristics This is a rabbit polyclonal antibody against KIAA0284. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KIAA0284
Background The specific function of the protein remains unknown.
Molecular Weight 171kDa
Gene ID 283638
NCBI Accession NP_001106197, NM_001112726
UniProt Q9Y4F5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KIAA0284 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Heilig, Eckenberg, Petit et al.: "The DNA sequence and analysis of human chromosome 14." in: Nature, Vol. 421, Issue 6923, pp. 601-7, 2003 (PubMed).

Alternatives for antigen "Centrosomal Protein 170B (CEP170B)", type "Antibodies"
Hosts (3)
Reactivities (2), (1)
Applications (3), (2), (1)
Epitopes (1), (1)
Beacon