Did you know that you can buy products from over 140 different suppliers from us?

Centrosomal Protein 170B (CEP170B) (N-Term) antibody

Details for Product No. ABIN503657
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CEP170R, FAM68C, KIAA0284, AI466840, AW555464, Kiaa0284, mKIAA0284, kiaa0284
Epitope
N-Term
(1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Xenopus laevis, Human
(3), (1)
Host
Rabbit
(4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4), (2), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503657
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the n terminal of human KIAA0284
Sequence QLTKARKQEEDDSLSDAGTYTIETEAQDTEVEEARKMIDQ VFGVLESPEL
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Dog : 90 %, Guinea pig : 90 %
Characteristics This is a rabbit polyclonal antibody against KIAA0284. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KIAA0284
Background The specific function of the protein remains unknown.
Molecular Weight 171 kDa
Gene ID 283638
NCBI Accession NM_001112726, NP_001106197
UniProt Q9Y4F5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1554 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Centrosomal Protein 170B (CEP170B) (N-Term) antibody WB Suggested Anti-KIAA0284 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Muscle
Background publications Heilig, Eckenberg, Petit et al.: "The DNA sequence and analysis of human chromosome 14...." in: Nature, Vol. 421, Issue 6923, pp. 601-7, 2003 (PubMed).

Hosts (4)
Reactivities (3), (1)
Applications (4), (2), (2)
Epitopes (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503657
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top