Deleted in Primary Ciliary Dyskinesia Homolog (Mouse) (DPCD) antibody

Antigen: Deleted in Primary Ciliary Dyskinesia Homolog (Mouse) (DPCD)

Synonyms: Ndac, 5330431N19Rik, RGD1307648, MGC153412, zgc:153412

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine)

Application: Western Blotting (WB)

Catalog no.: ABIN503667

Additional Information

Alternative name: DPCD

Gene ID: RP11-529I10.4

UniProt: Q9BVM2

Immunogen: The immunogen for anti-RP11-529I10.4 antibody: synthetic peptide directed towards the N terminal of human RP11-529I10.4

Sequence: MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLG AGNLGPELIK

Cross-Reactivity: Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-RP11-529I10.4 antibody concentration is 1 mg/ml.

Description: RP11-529I10.4 (DPCD) belongs to the DPCD family. It may play a role in the formation or function of ciliated cells. Deletion of the DPCD gene may be a cause of primary ciliary dyskinesia (PCD).

Characteristics: Antigen Size: 203 amino acids

Molecular Weight: 23kDa

Application Details

Application Notes: WB Suggested Anti-RP11-529I10.4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-RP11-529I10.4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 721_B cell lysate

Publications

Product: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).