DPCD antibody (N-Term)
-
- Target See all DPCD Antibodies
- DPCD (Deleted in Primary Ciliary Dyskinesia Homolog (DPCD))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DPCD antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- RP11-529 I10.4 antibody was raised against the N terminal of RP11-529 10.4
- Purification
- Affinity purified
- Immunogen
- RP11-529 I10.4 antibody was raised using the N terminal of RP11-529 10.4 corresponding to a region with amino acids MAEEYDEKTSELLVRKWRVKSALGAMGQWQLEVGDPAPLGAGNLGPELIK
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RP11-529I10.4 Blocking Peptide, catalog no. 33R-5635, is also available for use as a blocking control in assays to test for specificity of this RP11-529I10.4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RP11-520 10.4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DPCD (Deleted in Primary Ciliary Dyskinesia Homolog (DPCD))
- Alternative Name
- RP11-529I10.4 (DPCD Products)
- Synonyms
- RP11-529I10.4 antibody, zgc:153412 antibody, rp11-529i10.4 antibody, 5330431N19Rik antibody, Ndac antibody, RGD1307648 antibody, deleted in primary ciliary dyskinesia homolog (mouse) antibody, deleted in a mouse model of primary ciliary dyskinesia S homeolog antibody, deleted in primary ciliary dyskinesia antibody, DPCD antibody, dpcd antibody, dpcd.S antibody, Dpcd antibody
- Background
- RP11-529I10.4 (DPCD) belongs to the DPCD family. It may play a role in the formation or function of ciliated cells. Deletion of the DPCD gene may be a cause of primary ciliary dyskinesia (PCD).
- Molecular Weight
- 23 kDa (MW of target protein)