Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503672

Retinoic Acid Induced 14 (RAI14) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NORPEG, RAI13, Norpeg, mKIAA1334, Ankycorbin, 1700008J19Rik, 1700020L11Rik, RAI14
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503672
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RAI14 antibody: synthetic peptide directed towards the middle region of human RAI14
Sequence ELSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQ LTNVSRAKAE
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Bovine : 92%, Chicken : 85%, Guinea pig : 85%
Characteristics This is a rabbit polyclonal antibody against RAI14. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RAI14
Background RAI14 contains 7 ANK repeats. The function of RAI14 remains unknown.
Molecular Weight 110kDa
Gene ID 26064
NCBI Accession NP_056392, NM_015577
UniProt Q9P0K7
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RAI14 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Retinoic Acid Induced 14 (RAI14)", type "Antibodies"
Hosts (9)
Reactivities (7), (3), (3), (1), (1)
Applications (7), (6), (2), (1)
Epitopes (2), (1), (1)
Beacon