Retinoic Acid Induced 14 (RAI14) (Middle Region) antibody

Details for Product No. ABIN503672
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NORPEG, RAI13, Norpeg, mKIAA1334, Ankycorbin, 1700008J19Rik, 1700020L11Rik, RAI14
Epitope
Middle Region
(2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(7), (3), (3), (1), (1)
Host
Rabbit
(9)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (4), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN503672
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RAI14
Sequence ELSQLYKEAQAELEDYRKRKSLEDVTAEYIHKAEHEKLMQ LTNVSRAKAE
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %, Chicken : 80 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against RAI14. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RAI14
Background RAI14 contains 7 ANK repeats. The function of RAI14 remains unknown.
Molecular Weight 110 kDa
Gene ID 26064
NCBI Accession NM_015577, NP_056392
UniProt Q9P0K7
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 980 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Retinoic Acid Induced 14 (RAI14) (Middle Region) antibody WB Suggested Anti-RAI14 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: COLO205 cell lysate
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Hosts (9)
Reactivities (7), (3), (3), (1), (1)
Applications (7), (4), (2), (1)
Epitopes (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top