Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

SUMO1/sentrin Specific Peptidase 5 (SENP5) antibody

Antigen

SUMO1/sentrin Specific Peptidase 5 (SENP5)

Synonyms FLJ42398, MGC27076, DKFZp564O1016
Clonality Polyclonal
Host
Alternatives

Rabbit

Reactivity
Alternatives

Dog (Canine), Human, Mouse (Murine), Rat (Rattus)

Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN503708
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

Additional Information

Alternative name SENP5
Gene ID SENP5
UniProt Q96HI0
Immunogen The immunogen for anti-SENP5 antibody: synthetic peptide directed towards the middle region of human SENP5
Sequence LSGFLDEVMKKYGSLVPLSEKEVLGRLKDVFNEDFSNRKP FINREITNYR
Cross-Reactivity Dog (Canine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-SENP5 antibody concentration is 1 mg/ml.
Description The reversible posttranslational modification of proteins by the addition of small ubiquitin-like SUMO proteins (see SUMO1, MIM 601912) is required for numerous biologic processes. SUMO-specific proteases, such as SENP5, are responsible for the initial processing of SUMO precursors to generate a C-terminal diglycine motif required for the conjugation reaction. They also have isopeptidase activity for the removal of SUMO from high molecular mass SUMO conjugates.
Characteristics Antigen Size: 755 amino acids
Molecular Weight 87kDa

Application Details

Application Notes WB Suggested Anti-SENP5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Proteolysis / Ubiquitin
Restrictions For Research Use only

Publications

Product Gong, Yeh: "Characterization of a family of nucleolar SUMO-specific proteases with preference for SUMO-2 or SUMO-3." in: The Journal of biological chemistry, Vol. 281, Issue 23, pp. 15869-77, 2006 (PubMed).

Alternatives

Alternatives for antigen "SUMO1/sentrin Specific Peptidase 5 (SENP5)", type "Antibodies"
Hosts Rabbit (36)
Reactivities Human (34), Mouse (Murine) (23), Rat (Rattus) (22), Cow (Bovine) (18), Dog (Canine) (18), Horse (Equine) (18), Pig (Porcine) (18), Rabbit (18)
Applications Western Blotting (WB) (20), ELISA (15), Immunofluorescence (IF) (15), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (7), Immunohistochemistry (IHC) (6), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1)
Epitopes C-Term (5), AA 229-246 (2), C-Term,AA 717-747 (1), Internal Region (1)