Did you know that you can buy products from over 140 different suppliers from us?

Taperin (TPRN) (Middle Region) antibody

Details for Product No. ABIN503736
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C9orf75, DFNB79, RP11-350O14.7, C430004E15Rik, C87750, RP23-132N23.15
Epitope
Middle Region
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(3), (1), (1), (1)
Host
Rabbit
(5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503736
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C9orf75
Sequence EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDL SDFRSEPALY
Predicted Reactivity Mouse :100 %,   Human :100 %,   Rat :100 %,   Bovine :90 %,  
Characteristics This is a rabbit polyclonal antibody against C9orf75. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C9orf75
Background The specific function of C9orf75 is not yet known.
Molecular Weight 47 kDa
Gene ID 286262
NCBI Accession NM_173691, NP_775962
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 433 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Taperin (TPRN) (Middle Region) antibody WB Suggested Anti-C9orf75 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human Thymus
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Validation Images
back to top