Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN503736

Taperin (TPRN) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C430004E15Rik, C87750, RP23-132N23.15, C9orf75, DFNB79, RP11-350O14.7
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN503736
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C9orf75 antibody: synthetic peptide directed towards the middle region of human C9orf75
Sequence EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDL SDFRSEPALY
Predicted Reactivity Mouse :100%,   Human :100%,   Rat :100%,   Bovine :92%,  
Characteristics This is a rabbit polyclonal antibody against C9orf75. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name C9orf75
Background The specific function of C9orf75 is not yet known.
Molecular Weight 47kDa
Gene ID 286262
NCBI Accession NP_775962, NM_173691
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C9orf75 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Alternatives for antigen "Taperin (TPRN)", type "Antibodies"
Hosts (5)
Reactivities (3), (1), (1), (1)
Applications (5)
Epitopes (2), (1)
Beacon