RasGEF Domain Family, Member 1C (RASGEF1C) (Middle Region) antibody

Details for Product No. ABIN503742
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 9130006A14Rik, RASGEF1C
Epitope
Middle Region
(10), (7), (6), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Pig (Porcine), Cow (Bovine), Human, Chicken
(23), (1), (1), (1)
Host
Rabbit
(14), (11)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(25), (16), (6), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN503742
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human RASGEF1C
Sequence FLELAKQVGEFITWKQVECPFEQDASITHYLYTAPIFSED GLYLASYESE
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against RASGEF1C. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RASGEF1C
Background RASGEF1C is the guanine nucleotide exchange factor (GEF).
Molecular Weight 53 kDa
Gene ID 255426
NCBI Accession NM_175062, NP_778232
UniProt Q8N431
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 466 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-RasGEF Domain Family, Member 1C (RASGEF1C) (Middle Region) antibody WB Suggested Anti-RASGEF1C Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart
Background publications Bonaldo, Lennon, Soares: "Normalization and subtraction: two approaches to facilitate gene discovery." in: Genome research, Vol. 6, Issue 9, pp. 791-806, 1997 (PubMed).

Hosts (14), (11)
Reactivities (23), (1), (1), (1)
Applications (25), (16), (6), (3), (2)
Conjugates (2), (2), (2), (2), (2), (2)
Epitopes (10), (7), (6), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top