Did you know that you can buy products from over 140 different suppliers from us?

EF-Hand Domain Family, Member A2 (EFHA2) (N-Term) antibody

Details for Product No. ABIN503757
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2900075B16Rik, Efha2, EFHA2
Epitope
N-Term
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(3)
Host
Rabbit
(3), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5), (2)
Pubmed 2 references available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN503757
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human EFHA2
Sequence AAAGGGLVGLVCYQLYGDPRAGSPATGRPSKSAATEPEDP PRGRGMLPIP
Predicted Reactivity Human : 100 %, Mouse : 100 %, Rabbit : 90 %, Bovine : 90 %, Pig : 90 %
Characteristics This is a rabbit polyclonal antibody against EFHA2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EFHA2
Background The specific function of this protein remains unknown.
Molecular Weight 61 kDa
Gene ID 286097
NCBI Accession NM_181723, NP_859074
UniProt Q86XE3
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 530 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-EF-Hand Domain Family, Member A2 (EFHA2) (N-Term) antibody WB Suggested Anti-EFHA2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 293T cell lysate
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Hosts (3), (2)
Reactivities (3)
Applications (5), (2)
Epitopes (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN503757
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top